C9orf64 Antibody

Name C9orf64 Antibody
Supplier Novus Biologicals
Catalog NBP1-91506
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human C9orf64. Peptide sequence RVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C9orf64
Conjugate Unconjugated
Supplier Page Shop

Product images