OTUD6A Antibody
| Name | OTUD6A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91497 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OTUD6A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: OTUD6A Antibody [NBP1-91497] - Overexpressed protein in HeLa, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6883_OTUD6A-Antibody-Western-Blot-NBP1-91497-img0001.jpg)
Western Blot: OTUD6A Antibody [NBP1-91497] - Overexpressed protein in HeLa, Antibody Titration: 0.2-1 ug/ml
![Western Blot: OTUD6A Antibody [NBP1-91497] - Human Hela cell line, 15 micrograms per LaneUsed at both 1 : 500 and 1 : 1000 (in 5% Milk in PBS/0.05% Tween). Primary was incubated for 2hrs at 4 degrees Celsius. Both work, but 1 : 500 gave a stronger signal.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6884_OTUD6A%2520Antibody-Western%2520Blot-NBP1-91497-img0002.jpg)
Western Blot: OTUD6A Antibody [NBP1-91497] - Human Hela cell line, 15 micrograms per LaneUsed at both 1 : 500 and 1 : 1000 (in 5% Milk in PBS/0.05% Tween). Primary was incubated for 2hrs at 4 degrees Celsius. Both work, but 1 : 500 gave a stronger signal.