TCF23 Antibody
| Name | TCF23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91533 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the C terminal of mouse TCF23. Peptide sequence PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Tcf23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TCF23 Antibody [NBP1-91533] - SP2/0 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15878_TCF23%2520Antibody-Western%2520Blot-NBP1-91533-img0002.jpg)
Western Blot: TCF23 Antibody [NBP1-91533] - SP2/0 cell lysate, concentration 2.5 ug/ml.