Obox6 Antibody

Name Obox6 Antibody
Supplier Novus Biologicals
Catalog NBP1-91619
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Mouse
Antigen Synthetic peptide directed towards the middle region of mouse OBOX6. Peptide sequence MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene Obox6
Supplier Page Shop

Product images