C1orf159/RIVIG Antibody

Name C1orf159/RIVIG Antibody
Supplier Novus Biologicals
Catalog NBP1-91308
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human C1orf159. Peptide sequence PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C1orf159
Conjugate Unconjugated
Supplier Page Shop

Product images