Hemoglobin gamma-2 chain Antibody

Name Hemoglobin gamma-2 chain Antibody
Supplier Novus Biologicals
Catalog NBP1-98291
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for this antibody is Hemoglobin gamma-2 chain - middle region. Peptide sequence MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HBG2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.