Calmodulin 3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-98474
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: The immunogen for this antibody is Calmodulin 3 - N-terminal region. Peptide sequence LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CALM3
• Conjugate: Unconjugated

Product images

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human HepG2, Antibody Dilution: 1.0 ug/ml CALM3 is supported by BioGPS gene expression data to be expressed in HepG2.

Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human MCF7, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.