FXYD3 Antibody
| Name | FXYD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005349-A01 |
| Prices | $269.00 |
| Sizes | 50 µl |
| Host | Mouse |
| Clonality | Polyclonal |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | FXYD3 (AAH05238, 21 a.a. - 87 a.a.) full-length recombinant protein with GST tag. NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS |
| Purity/Format | Unpurified |
| Description | Mouse Polyclonal |
| Gene | FXYD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FXYD3 Antibody [H00005349-A01] - FXYD3 polyclonal antibody (A01), Lot # ISI4060209QCS1 Western Blot analysis of FXYD3 expression in A-431 ( Cat # L015V1 ).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17850_FXYD3-Antibody-Western-Blot-H00005349-A01-img0001.jpg)
Western Blot: FXYD3 Antibody [H00005349-A01] - FXYD3 polyclonal antibody (A01), Lot # ISI4060209QCS1 Western Blot analysis of FXYD3 expression in A-431 ( Cat # L015V1 ).