NME3 Antibody (3G10)
| Name | NME3 Antibody (3G10) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004832-M13 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3G10 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | NME3 (NP_002504.2 73 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | NME3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NME3 Antibody (3G10) [H00004832-M13] - Analysis of NME3 expression in transfected 293T cell line by NME3 monoclonal antibody (M13), clone 3G10. Lane 1: NME3 transfected lysatE (19 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10730_NME3%2520Antibody%2520(3G10)-Western%2520Blot-H00004832-M13-img0003.jpg)
Western Blot: NME3 Antibody (3G10) [H00004832-M13] - Analysis of NME3 expression in transfected 293T cell line by NME3 monoclonal antibody (M13), clone 3G10. Lane 1: NME3 transfected lysatE (19 KDa). Lane 2: Non-transfected lysate.
![Sandwich ELISA: NME3 Antibody (3G10) [H00004832-M13] - Detection limit for recombinant GST tagged NME3 is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10731_NME3-Antibody-(3G10)-Sandwich-ELISA-H00004832-M13-img0002.jpg)
Sandwich ELISA: NME3 Antibody (3G10) [H00004832-M13] - Detection limit for recombinant GST tagged NME3 is 0.3 ng/ml as a capture antibody.