Chitobiase/CTBS Antibody (1B5-1B9)

Name Chitobiase/CTBS Antibody (1B5-1B9)
Supplier Novus Biologicals
Catalog H00001486-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG1 Kappa
Clone 1B5-1B9
Applications WB ELISA
Species Reactivities Human
Antigen CTBS (AAH24007.2, 37 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
Purity/Format IgG purified
Description Mouse Monoclonal
Gene CTBS
Conjugate Unconjugated
Supplier Page Shop

Product images