Name | Chitobiase/CTBS Antibody (1B5-1B9) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001486-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 1B5-1B9 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | CTBS (AAH24007.2, 37 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | CTBS |
Conjugate | Unconjugated |
Supplier Page | Shop |