SNRPG Antibody (2H8-1C12)
| Name | SNRPG Antibody (2H8-1C12) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006637-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 2H8-1C12 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | SNRPG (AAH00070, 1 a.a. - 76 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | SNRPG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - SNRPG monoclonal antibody (M01), clone 2H8-1C12 Analysis of SNRPG expression in Hela S3 NE.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8599_SNRPG-Antibody-(2H8-1C12)-Western-Blot-H00006637-M01-img0002.jpg)
Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - SNRPG monoclonal antibody (M01), clone 2H8-1C12 Analysis of SNRPG expression in Hela S3 NE.
![Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - Analysis of SNRPG expression in transfected 293T cell line by SNRPG monoclonal antibody (M01), clone 2H8-1C12.Lane 1: SNRPG transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8600_SNRPG%2520Antibody%2520(2H8-1C12)-Western%2520Blot-H00006637-M01-img0003.jpg)
Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - Analysis of SNRPG expression in transfected 293T cell line by SNRPG monoclonal antibody (M01), clone 2H8-1C12.Lane 1: SNRPG transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.