CKS2 Antibody (2G12-2A5)
| Name | CKS2 Antibody (2G12-2A5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001164-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 2G12-2A5 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CKS2 (AAH06458, 1 a.a. - 79 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CKS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M02), clone 2G12-2A5.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8515_CKS2%2520Antibody%2520(2G12-2A5)-Western%2520Blot-H00001164-M02-img0003.jpg)
Western Blot: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M02), clone 2G12-2A5.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Detection limit for recombinant GST tagged CKS2 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8516_CKS2-Antibody-(2G12-2A5)-Sandwich-ELISA-H00001164-M02-img0002.jpg)
Sandwich ELISA: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Detection limit for recombinant GST tagged CKS2 is approximately 0.1ng/ml as a capture antibody.