Name | CKS2 Antibody (2G12-2A5) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001164-M02 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 2G12-2A5 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | CKS2 (AAH06458, 1 a.a. - 79 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | CKS2 |
Conjugate | Unconjugated |
Supplier Page | Shop |