| Name | ATF6 beta Antibody (4D10) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001388-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 4D10 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | CREBL1 (NP_004372.3, 2 a.a. - 88 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | ATF6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |