PER3 Antibody (3A7)
| Name | PER3 Antibody (3A7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008863-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3A7 |
| Applications | WB ELISA IP |
| Species Reactivities | Human |
| Antigen | PER3 (NP_058515.1 1105 a.a. - 1201 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | PER3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: PER3 Antibody (3A7) [H00008863-M01] - Detection limit for recombinant GST tagged PER3 is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10197_PER3%2520Antibody%2520(3A7)-Sandwich%2520ELISA-H00008863-M01-img0002.jpg)
Sandwich ELISA: PER3 Antibody (3A7) [H00008863-M01] - Detection limit for recombinant GST tagged PER3 is 0.3 ng/ml as a capture antibody.
![Immunoprecipitation: PER3 Antibody (3A7) [H00008863-M01] - Analysis of PER3 transfected lysate using anti-PER3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PER3 MaxPab rabbit polyclonal antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10198_PER3-Antibody-(3A7)-Immunoprecipitation-H00008863-M01-img0001.jpg)
Immunoprecipitation: PER3 Antibody (3A7) [H00008863-M01] - Analysis of PER3 transfected lysate using anti-PER3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PER3 MaxPab rabbit polyclonal antibody.