Name | GCM1 Antibody (3G7) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008521-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 3G7 |
Applications | ELISA ICC/IF |
Species Reactivities | Human |
Antigen | GCM1 (NP_003634, 108 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | GCM1 |
Conjugate | Unconjugated |
Supplier Page | Shop |