Name | GTF3A Antibody (1C6) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002971-M08 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 1C6 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | GTF3A (NP_002088 185 a.a. - 274 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | GTF3A |
Conjugate | Unconjugated |
Supplier Page | Shop |