Name | GDC Antibody (1H7) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008034-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1H7 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | SLC25A16 (NP_689920.1, 59 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR |
Purity/Format | Protein A purified |
Description | Mouse Monoclonal |
Gene | SLC25A16 |
Conjugate | Unconjugated |
Supplier Page | Shop |