ZNF85 Antibody (2G9)
| Name | ZNF85 Antibody (2G9) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007639-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 2G9 |
| Applications | ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | ZNF85 (NP_003420, 2 a.a. - 76 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | ZNF85 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZNF85 Antibody (2G9) [H00007639-M02] - Analysis of monoclonal antibody to ZNF85 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21675_ZNF85%2520Antibody%2520(2G9)-Immunohistochemistry-Paraffin-H00007639-M02-img0003.jpg)
Immunohistochemistry-Paraffin: ZNF85 Antibody (2G9) [H00007639-M02] - Analysis of monoclonal antibody to ZNF85 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.