Corneodesmosin Antibody (6F11)
| Name | Corneodesmosin Antibody (6F11) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001041-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 6F11 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CDSN (NP_001255 306 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CDSN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: Corneodesmosin Antibody (6F11) [H00001041-M01] - Detection limit for recombinant GST tagged CDSN is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28132_Corneodesmosin%2520Antibody%2520(6F11)-Sandwich%2520ELISA-H00001041-M01-img0002.jpg)
Sandwich ELISA: Corneodesmosin Antibody (6F11) [H00001041-M01] - Detection limit for recombinant GST tagged CDSN is approximately 0.03ng/ml as a capture antibody.