SGLT2/SLC5A2 Antibody (3G8)
| Name | SGLT2/SLC5A2 Antibody (3G8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006524-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3G8 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | SLC5A2 (NP_003032.1 228 a.a. - 277 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | SLC5A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.Lane 1: SLC5A2 transfected lysate(72.9 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8287_SGLT2-SLC5A2%2520Antibody%2520(3G8)-Western%2520Blot-H00006524-M01-img0003.jpg)
Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.Lane 1: SLC5A2 transfected lysate(72.9 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/8288_SGLT2-SLC5A2-Antibody-(3G8)-Sandwich-ELISA-H00006524-M01-img0002.jpg)
Sandwich ELISA: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.