MTMR1 Antibody (1F10)
| Name | MTMR1 Antibody (1F10) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008776-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1F10 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | MTMR1 (NP_003819.1, 39 a.a. - 112 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | MTMR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MTMR1 Antibody (1F10) [H00008776-M01] - Analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody (M01), clone 1F10.Lane 1: MTMR1 transfected lysate(39.8 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9665_MTMR1%2520Antibody%2520(1F10)-Western%2520Blot-H00008776-M01-img0003.jpg)
Western Blot: MTMR1 Antibody (1F10) [H00008776-M01] - Analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody (M01), clone 1F10.Lane 1: MTMR1 transfected lysate(39.8 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: MTMR1 Antibody (1F10) [H00008776-M01] - Detection limit for recombinant GST tagged MTMR1 is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9666_MTMR1-Antibody-(1F10)-Sandwich-ELISA-H00008776-M01-img0002.jpg)
Sandwich ELISA: MTMR1 Antibody (1F10) [H00008776-M01] - Detection limit for recombinant GST tagged MTMR1 is 0.3 ng/ml as a capture antibody.