Name | MTMR1 Antibody (1F10) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008776-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1F10 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | MTMR1 (NP_003819.1, 39 a.a. - 112 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | MTMR1 |
Conjugate | Unconjugated |
Supplier Page | Shop |