Name | GBX2 Antibody (1A7) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002637-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 1A7 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | GBX2 (NP_001476 114 a.a. - 182 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG |
Purity/Format | Protein A purified |
Description | Mouse Monoclonal |
Gene | GBX2 |
Conjugate | Unconjugated |
Supplier Page | Shop |