EEF1B2 Antibody (3A5)
| Name | EEF1B2 Antibody (3A5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001933-M10 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3A5 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | EEF1B2 (NP_001950.1, 29 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | EEF1B2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10] - Analysis of EEF1B2 expression in HeLa (Cat # L013V1).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10883_EEF1B2%2520Antibody%2520(3A5)-Western%2520Blot-H00001933-M10-img0002.jpg)
Western Blot: EEF1B2 Antibody (3A5) [H00001933-M10] - Analysis of EEF1B2 expression in HeLa (Cat # L013V1).