Name | Creatine kinase MT 1B Antibody (2C9) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001159-M16 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 2C9 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | CKMT1B (NP_066270 327 a.a. - 417 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
Purity/Format | Protein A purified |
Description | Mouse Monoclonal |
Gene | CKMT1B |
Conjugate | Unconjugated |
Supplier Page | Shop |