PCP4 Antibody (1E3.)

Name PCP4 Antibody (1E3.)
Supplier Novus Biologicals
Catalog H00005121-M14
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 1E3.
Applications WB ELISA
Species Reactivities Human
Antigen PCP4 (NP_006189.2, 1 a.a. - 62 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Purity/Format IgG purified
Description Mouse Monoclonal
Gene PCP4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.