G gamma14 Antibody (1G11-C7)
| Name | G gamma14 Antibody (1G11-C7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002793-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 1G11-C7 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | GNGT2 (AAH08663, 1 a.a. - 69 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GNGT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: G gamma14 Antibody (1G11-C7) [H00002793-M01] - Detection limit for recombinant GST tagged GNGT2 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/20028_G%2520gamma14%2520Antibody%2520(1G11-C7)-Sandwich%2520ELISA-H00002793-M01-img0002.jpg)
Sandwich ELISA: G gamma14 Antibody (1G11-C7) [H00002793-M01] - Detection limit for recombinant GST tagged GNGT2 is approximately 0.03ng/ml as a capture antibody.