MEF2B Antibody (4B5)

Name MEF2B Antibody (4B5)
Supplier Novus Biologicals
Catalog H00004207-M24
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 4B5
Applications WB ELISA
Species Reactivities Human
Antigen MEF2B (NP_005910.1 165 a.a. - 235 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Purity/Format IgG purified
Description Mouse Monoclonal
Gene MEF2BNB-MEF2B
Conjugate Unconjugated
Supplier Page Shop

Product images