Name | IGSF1 Antibody (4C7) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00003547-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 4C7 |
Applications | WB ELISA |
Species Reactivities | Human, Rat |
Antigen | IGSF1 (NP_001546 220 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | IGSF1 |
Conjugate | Unconjugated |
Supplier Page | Shop |