PHKA2 Antibody (3H3)
| Name | PHKA2 Antibody (3H3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005256-M04 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3H3 |
| Applications | ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | PHKA2 (NP_000283 428 a.a. - 521 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PHKA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PHKA2 Antibody (3H3) [H00005256-M04] - Analysis of monoclonal antibody to PHKA2 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 3 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21854_PHKA2-Antibody-(3H3)-Immunohistochemistry-Paraffin-H00005256-M04-img0001.jpg)
Immunohistochemistry-Paraffin: PHKA2 Antibody (3H3) [H00005256-M04] - Analysis of monoclonal antibody to PHKA2 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 3 ug/ml