HSBP1 Antibody (2C3)

• Supplier: Novus Biologicals
• Catalog: H00003281-M02
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 2C3
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: HSBP1 (AAH07515, 1 a.a. - 76 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: HSBP1
• Conjugate: Unconjugated