dystrophia myotonica containing WD repeat motif Antibody (3F5)
| Name | dystrophia myotonica containing WD repeat motif Antibody (3F5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001762-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 3F5 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | DMWD (AAH19266 245 a.a. - 334 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWARPGKAGISSQPGNSPSGTVV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DMWD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: dystrophia myotonica containing WD repeat motif Antibody (3F5) [H00001762-M01] - Analysis of DMWD expression in transfected 293T cell line by DMWD monoclonal antibody (M01), clone 3F5.Lane 1: DMWD transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/20375_dystrophia%2520myotonica%2520containing%2520WD%2520repeat%2520motif%2520Antibody%2520(3F5)-Western%2520Blot-H00001762-M01-img0001.jpg)
Western Blot: dystrophia myotonica containing WD repeat motif Antibody (3F5) [H00001762-M01] - Analysis of DMWD expression in transfected 293T cell line by DMWD monoclonal antibody (M01), clone 3F5.Lane 1: DMWD transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.