Metallothionein-3 Antibody (3E8.)

• Supplier: Novus Biologicals
• Catalog: H00004504-M01A
• Prices: $359.00
• Sizes: 200 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgM Kappa
• Clone: 3E8.
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: MT3 (AAH13081, 1 a.a. - 68 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
• Purity/Format: Unpurified
• Description: Mouse Monoclonal
• Gene: MT3
• Conjugate: Unconjugated