PIGC Antibody (1G2)
| Name | PIGC Antibody (1G2) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005279-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1G2 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | PIGC (NP_002633, 1 a.a. - 54 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PIGC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: PIGC Antibody (1G2) [H00005279-M01] - Detection limit for recombinant GST tagged PIGC is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/19410_PIGC%2520Antibody%2520(1G2)-Sandwich%2520ELISA-H00005279-M01-img0001.jpg)
Sandwich ELISA: PIGC Antibody (1G2) [H00005279-M01] - Detection limit for recombinant GST tagged PIGC is 0.3 ng/ml as a capture antibody.