Glutathione S-transferase Mu 5 Antibody (1G4)
| Name | Glutathione S-transferase Mu 5 Antibody (1G4) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002949-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 1G4 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | GSTM5 (NP_000842 145 a.a. - 218 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GSTM5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: Glutathione S-transferase Mu 5 Antibody (1G4) [H00002949-M02] - Detection limit for recombinant GST tagged GSTM5 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21692_Glutathione%2520S-transferase%2520Mu%25205%2520Antibody%2520(1G4)-Sandwich%2520ELISA-H00002949-M02-img0002.jpg)
Sandwich ELISA: Glutathione S-transferase Mu 5 Antibody (1G4) [H00002949-M02] - Detection limit for recombinant GST tagged GSTM5 is approximately 0.03ng/ml as a capture antibody.