Name | Glutathione S-transferase Mu 5 Antibody (1G4) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002949-M02 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 1G4 |
Applications | ELISA |
Species Reactivities | Human |
Antigen | GSTM5 (NP_000842 145 a.a. - 218 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | GSTM5 |
Conjugate | Unconjugated |
Supplier Page | Shop |