Name | Mad Antibody (2G10) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00004084-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 2G10 |
Applications | ELISA IHC-P |
Species Reactivities | Human |
Antigen | MXD1 (NP_002348.1, 60 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | MXD1 |
Conjugate | Unconjugated |
Supplier Page | Shop |