HOXD4 Antibody (1H7)

Name HOXD4 Antibody (1H7)
Supplier Novus Biologicals
Catalog H00003233-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 1H7
Applications WB ELISA
Species Reactivities Human
Antigen HOXD4 (NP_055436.2, 1 a.a. - 62 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF
Purity/Format Protein A purified
Description Mouse Monoclonal
Gene HOXD4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.