Dfna5 deafness Antibody (1E10.)
| Name | Dfna5 deafness Antibody (1E10.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001687-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1E10. |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | DFNA5 (NP_004394.1 111 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | DFNA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dfna5 deafness Antibody (1E10) [H00001687-M01] - Analysis of DFNA5 expression in transfected 293T cell line by DFNA5 monoclonal antibody (M01), clone 1E10.Lane 1: DFNA5 transfected lysate (Predicted MW: 54.6 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12134_Dfna5%2520deafness%2520Antibody%2520(1E10)-Western%2520Blot-H00001687-M01-img0002.jpg)
Western Blot: Dfna5 deafness Antibody (1E10) [H00001687-M01] - Analysis of DFNA5 expression in transfected 293T cell line by DFNA5 monoclonal antibody (M01), clone 1E10.Lane 1: DFNA5 transfected lysate (Predicted MW: 54.6 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: Dfna5 deafness Antibody (1E10) [H00001687-M01] - Detection limit for recombinant GST tagged DFNA5 is 3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12135_Dfna5-deafness-Antibody-(1E10)-Sandwich-ELISA-H00001687-M01-img0001.jpg)
Sandwich ELISA: Dfna5 deafness Antibody (1E10) [H00001687-M01] - Detection limit for recombinant GST tagged DFNA5 is 3 ng/ml as a capture antibody.