Dystrobrevin beta Antibody (1D3)
| Name | Dystrobrevin beta Antibody (1D3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001838-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1D3 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | DTNB (NP_899205, 1 a.a. - 89 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DTNB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![ELISA: Dystrobrevin beta Antibody (1D3) [H00001838-M03] - Detection limit for recombinant GST tagged DTNB is approximately 1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21666_Dystrobrevin-beta-Antibody-(1D3)-ELISA-H00001838-M03-img0001.jpg)
ELISA: Dystrobrevin beta Antibody (1D3) [H00001838-M03] - Detection limit for recombinant GST tagged DTNB is approximately 1ng/ml as a capture antibody.