SLC26A4 Antibody (3D2)

Name SLC26A4 Antibody (3D2)
Supplier Novus Biologicals
Catalog H00005172-M03
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 3D2
Applications ELISA
Species Reactivities Human
Antigen SLC26A4 (NP_000432 674 a.a. - 754 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
Purity/Format IgG purified
Description Mouse Monoclonal
Gene SLC26A4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.