Name | SLC26A4 Antibody (3D2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00005172-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 3D2 |
Applications | ELISA |
Species Reactivities | Human |
Antigen | SLC26A4 (NP_000432 674 a.a. - 754 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | SLC26A4 |
Conjugate | Unconjugated |
Supplier Page | Shop |