PIN/DLC8 Antibody (1H7)

• Supplier: Novus Biologicals
• Catalog: H00008655-M02
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1H7
• Applications: WB ELISA ICC/IF
• Species Reactivities: Human
• Antigen: DYNLL1 (NP_003737.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: DYNLL1
• Conjugate: Unconjugated

Product images

Western Blot: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of DYNLL1 expression in transfected 293T cell line by DYNLL1 monoclonal antibody (M02), clone 1H7.Lane 1: DYNLL1 transfected lysate(10.4 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of monoclonal antibody to DYNLL1 on HeLa cell. Antibody concentration 10 ug/ml.

Sandwich ELISA: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Detection limit for recombinant GST tagged DYNLL1 is 0.1 ng/ml as a capture antibody.