GTF3A Antibody (4G4)
| Name | GTF3A Antibody (4G4) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002971-M06 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 4G4 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | GTF3A (NP_002088 185 a.a. - 274 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GTF3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![ELISA: GTF3A Antibody (4G4) [H00002971-M06] - Detection limit for recombinant GST tagged GTF3A is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21624_GTF3A-Antibody-(4G4)-ELISA-H00002971-M06-img0001.jpg)
ELISA: GTF3A Antibody (4G4) [H00002971-M06] - Detection limit for recombinant GST tagged GTF3A is approximately 0.3ng/ml as a capture antibody.