| Name | COX15 Antibody (2D2) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001355-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2D2 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | COX15 (NP_510870, 92 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | COX15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |