Metallothionein-2A Antibody (6G2)
| Name | Metallothionein-2A Antibody (6G2) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004502-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Lambda |
| Clone | 6G2 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | MT2A (NP_005944.1, 1 a.a. - 61 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | MT2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2693_Metallothionein-2A-Antibody-(6G2)-Immunocytochemistry-Immunofluorescence-H00004502-M01-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell. Antibody concentration 10 ug/ml.
![Sandwich ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2694_Metallothionein-2A%2520Antibody%2520(6G2)-Sandwich%2520ELISA-H00004502-M01-img0003.jpg)
Sandwich ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.