Name | GAT3 Antibody (2C3) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00006538-M10 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2C3 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | SLC6A11 (NP_055044.1 164 a.a. - 225 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR |
Purity/Format | Protein A purified |
Description | Mouse Monoclonal |
Gene | SLC6A11 |
Conjugate | Unconjugated |
Supplier Page | Shop |