Name | INPP4B Antibody (3F2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008821-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 3F2 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | INPP4B (AAH05273, 1 a.a. - 53 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | INPP4B |
Conjugate | Unconjugated |
Supplier Page | Shop |