GNGT1 Antibody (1F8)
| Name | GNGT1 Antibody (1F8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002792-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1F8 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | GNGT1 (AAH29367, 1 a.a. - 74 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GNGT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GNGT1 Antibody (1F8) [H00002792-M01] - Analysis of GNGT1 expression in transfected 293T cell line by GNGT1 monoclonal antibody (M01), clone 1F8.Lane 1: GNGT1 transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10953_GNGT1%2520Antibody%2520(1F8)-Western%2520Blot-H00002792-M01-img0002.jpg)
Western Blot: GNGT1 Antibody (1F8) [H00002792-M01] - Analysis of GNGT1 expression in transfected 293T cell line by GNGT1 monoclonal antibody (M01), clone 1F8.Lane 1: GNGT1 transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: GNGT1 Antibody (1F8) [H00002792-M01] - Detection limit for recombinant GST tagged GNGT1 is 1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10954_GNGT1-Antibody-(1F8)-Sandwich-ELISA-H00002792-M01-img0001.jpg)
Sandwich ELISA: GNGT1 Antibody (1F8) [H00002792-M01] - Detection limit for recombinant GST tagged GNGT1 is 1 ng/ml as a capture antibody.