Name | PMCA4 Antibody (2G8) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00000493-M07 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 2G8 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | ATP2B4 (NP_001675, 1 a.a. - 92 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | ATP2B4 |
Conjugate | Unconjugated |
Supplier Page | Shop |