DEFA6 Antibody (2D2)
| Name | DEFA6 Antibody (2D2) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001671-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2D2 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | DEFA6 (NP_001917.1, 1 a.a. - 100 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DEFA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DEFA6 Antibody (2D2) [H00001671-M01] - Analysis of DEFA6 expression in transfected 293T cell line by DEFA6 monoclonal antibody (M01), clone 2D2.Lane 1: DEFA6 transfected lysate (Predicted MW: 11 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9335_DEFA6%2520Antibody%2520(2D2)-Western%2520Blot-H00001671-M01-img0002.jpg)
Western Blot: DEFA6 Antibody (2D2) [H00001671-M01] - Analysis of DEFA6 expression in transfected 293T cell line by DEFA6 monoclonal antibody (M01), clone 2D2.Lane 1: DEFA6 transfected lysate (Predicted MW: 11 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: DEFA6 Antibody (2D2) [H00001671-M01] - Detection limit for recombinant GST tagged DEFA6 is 1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9336_DEFA6-Antibody-(2D2)-Sandwich-ELISA-H00001671-M01-img0001.jpg)
Sandwich ELISA: DEFA6 Antibody (2D2) [H00001671-M01] - Detection limit for recombinant GST tagged DEFA6 is 1 ng/ml as a capture antibody.