Name | NRAP Antibody (1E9.) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00004892-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1E9. |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | NRAP (NP_932326.2 1640 a.a. - 1727 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | NRAP |
Conjugate | Unconjugated |
Supplier Page | Shop |