PPP3CC Antibody (4D1)
| Name | PPP3CC Antibody (4D1) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005533-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 4D1 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | PPP3CC (NP_005596.2, 1 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PPP3CC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PPP3CC Antibody (4D1) [H00005533-M01] - Analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11641_PPP3CC%2520Antibody%2520(4D1)-Western%2520Blot-H00005533-M01-img0002.jpg)
Western Blot: PPP3CC Antibody (4D1) [H00005533-M01] - Analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: PPP3CC Antibody (4D1) [H00005533-M01] - Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11642_PPP3CC-Antibody-(4D1)-Sandwich-ELISA-H00005533-M01-img0001.jpg)
Sandwich ELISA: PPP3CC Antibody (4D1) [H00005533-M01] - Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.